|
||||||
|
UniGene Name: biog3_v1.0_unigene25622
Length: 145 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene25622
T |
|
Ace file of the UniGene biog3_v1.0_unigene25622 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3868 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | glutamate synthase 1 [NADH] [Arabidopsis thaliana] ref|NP_001190529.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] ref|NP_001190530.1| glutamate synthase 1 [NADH] [Arabidopsis thaliana] sp|Q9LV03.2|GLUT1_ARATH RecName: Full=Glutamate synthase 1 [NA | - | - | 0.0 | 75% |
| FL-Next | sp=Glutamate synthase 1 [NADH], chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 78% |
| Blast2go | glutamate synthase 1 | - | - | 0.0 | 87% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glutamate synthase (NADH). | EC:1.4.1.14 | - | 0.0 | 87% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 87% | |
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 87% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 87% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 87% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 87% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | ammonia assimilation cycle | GO:0019676 | Biological Process | 0.0 | 87% |
| Blast2go | electron transport chain | GO:0022900 | Biological Process | 0.0 | 87% |
| Blast2go | glutamate biosynthetic process | GO:0006537 | Biological Process | 0.0 | 87% |
| Blast2go | developmental growth | GO:0048589 | Biological Process | 0.0 | 87% |
| Blast2go | nitrate assimilation | GO:0042128 | Biological Process | 0.0 | 87% |
| Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 87% |
| Blast2go | 3 iron, 4 sulfur cluster binding | GO:0051538 | Molecular Function | 0.0 | 87% |
| Blast2go | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | 87% |
| Blast2go | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | 87% |
| Blast2go | disulfide oxidoreductase activity | GO:0015036 | Molecular Function | 0.0 | 87% |
| Blast2go | iron ion binding | GO:0005506 | Molecular Function | 0.0 | 87% |
| Blast2go | FMN binding | GO:0010181 | Molecular Function | 0.0 | 87% |
| Blast2go | glutamate synthase (NADH) activity | GO:0016040 | Molecular Function | 0.0 | 87% |
| Blast2go | amyloplast | GO:0009501 | Cellular Component | 0.0 | 87% |
| Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 87% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 87% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 87% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamine amidotransferase, class-II | IPR000583 | - | 0.0 | - |
| Sma3 | IPR000759 | - | 0.0 | - | |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Glutamate synthase, alpha subunit, C-terminal | IPR002489 | - | 0.0 | - |
| Sma3 | Glutamate synthase, central-C | IPR002932 | - | 0.0 | - |
| Sma3 | Glutamate synthase, NADH/NADPH, small subunit 1 | IPR006005 | - | 0.0 | - |
| Sma3 | Glutamate synthase, central-N | IPR006982 | - | 0.0 | - |
| Sma3 | Glutamate synthase, eukaryotic | IPR012220 | - | 0.0 | - |
| Sma3 | Fumarate reductase, C-terminal | IPR012285 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | 4Fe-4S ferredoxin-type, iron-sulpur binding domain | IPR017896 | - | 0.0 | - |
| Sma3 | Glutamine amidotransferase, type II | IPR017932 | - | 0.0 | - |
| Sma3 | Rhodopsin, retinal binding site | IPR018229 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LV03
Fln msg: Distance to subject end: 797 aas, your sequence is shorter than subject: 48 - 2208
Fln protein:
Q
Protein Length:
49
Fln nts:
T
Fln Alignment:
biogeco3_mira_c27679___QYCVQAQDHGLDMALDQELIRISKAALEKGIPAYMEMPIRNVNRAV
Q9LV03__________________QYCVQKQDHGLDMALDQELIALSKSALEKSLPVYIETPICNVNRAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
