SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene23624

Length: 321 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene23624
ATCGACCCTGTCAGATCTGCAAACATCGAGCTGAGAGGAGCTTTTCGAATGTCCATAAGGAAAGTCCAACAGGGATCTGCAAACTCCGAGAGTAGGTACACCATGAATACTAAAGAAGACAGCAAGGAGAACTGTTCAGGATGGGCAGCTCGAGATCCATCAGGTGTTTTGTCACCTTACCAATTTAACCGAAGAGTCACAGGCCTTGATGATATCTCATTAAAGATAACTCATTGTGGAGTTTGTTACGCCGATGTTGCATGGACCCGGAATAAACTTGGTGATTCAAAGTATGAAGCAGCTGATGGGTTTGCAGACATT

Ace file of the UniGene biog3_v1.0_unigene23624 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene7938	1/2
SustainPine v2.0	sp_v2.0_unigene33987	1/2

Source	Descriptions	Term	Type	Identity
AutoFact	putative cinnamyl alcohol dehydrogenase 1 [Arabidopsis thaliana] sp\|Q9CAI3.1\|CADH1_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase 1; Short=AtCAD1 gb\|AAG51850.1\|AC010926_13 putative cinnamyl-alcohol dehydrogenase; 49641-51171 [Arabidopsis thal	-	-	70%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	86%
Blast2go	cinnamyl alcohol dehydrogenase	-	-	86%

Source	ECs	Term	Type	Identity
Blast2go	Mannitol dehydrogenase.	EC:1.1.1.255	-	86%
Blast2go	Arsenite-transporting ATPase.	EC:3.6.3.16	-	86%
Blast2go	Cinnamyl-alcohol dehydrogenase.	EC:1.1.1.195	-	86%

Source	KEGGs	Term	Type	Identity
Blast2go	Phenylpropanoid biosynthesis	00940		86%
Blast2go	Biosynthesis of phenylpropanoids	01061		86%
Blast2go	Metabolic pathways	01100		86%
Blast2go	Biosynthesis of secondary metabolites	01110		86%
Blast2go	Glutathione gamma-glutamylcysteinyltransferase.	EC:2.3.2.15	-	86%

Source	GOs	Term	Type	Identity
Blast2go	arsenite transport	GO:0015700	Biological Process	86%
Blast2go	indole glucosinolate catabolic process	GO:0042344	Biological Process	86%
Blast2go	immune response	GO:0006955	Biological Process	86%
Blast2go	phytochelatin biosynthetic process	GO:0046938	Biological Process	86%
Blast2go	defense response by callose deposition in cell wall	GO:0052544	Biological Process	86%
Blast2go	lignin biosynthetic process	GO:0009809	Biological Process	86%
Blast2go	response to arsenic-containing substance	GO:0046685	Biological Process	86%
Blast2go	defense response to bacterium	GO:0042742	Biological Process	86%
Blast2go	cell death	GO:0008219	Biological Process	86%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	86%
Blast2go	oxidation-reduction process	GO:0055114	Biological Process	86%
Blast2go	cofactor binding	GO:0048037	Molecular Function	86%
Blast2go	protein binding	GO:0005515	Molecular Function	86%
Blast2go	zinc ion binding	GO:0008270	Molecular Function	86%
Blast2go	mannitol dehydrogenase activity	GO:0046029	Molecular Function	86%
Blast2go	cadmium ion binding	GO:0046870	Molecular Function	86%
Blast2go	arsenite-transmembrane transporting ATPase activity	GO:0015446	Molecular Function	86%
Blast2go	copper ion binding	GO:0005507	Molecular Function	86%
Blast2go	cinnamyl-alcohol dehydrogenase activity	GO:0045551	Molecular Function	86%
Blast2go	glutathione gamma-glutamylcysteinyltransferase activity	GO:0016756	Molecular Function	86%
Blast2go	cytosol	GO:0005829	Cellular Component	86%
Blast2go	phytochelatin transmembrane transporter activity	GO:0071992	Biological Process	86%
Blast2go	phytochelatin transmembrane transport	GO:0071994	Biological Process	86%

Source	InterPros	Term	Type	Identity
Sma3	Alcohol dehydrogenase GroES-like	IPR013154	-	-
Sma3	Alcohol dehydrogenase superfamily, zinc-type	IPR002085	-	-
Sma3	Alcohol dehydrogenase, C-terminal	IPR013149	-	-
Sma3	Alcohol dehydrogenase, zinc-type, conserved site	IPR002328	-	-
Sma3	D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding	IPR006140	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NK95

Fln msg: Distance to subject end: 283 aas, your sequence is shorter than subject: 91 - 356

Fln protein: MSIRKVQQGSANSESRYTMNTKEDSKENCSGWAARDPSGVLSPYQFNRRVTGLDDISLKITHCGVCYADVAWTRNKLGDSKYEAADGFADI

Protein Length: 92

Fln nts: ATCGACCCTGTCAGATCTGCAAACATCGAGCTGAGAGGAGCTTTTCGA_-_ATGTCCATAAGGAAAGTCCAACAGGGATCTGCAAACTCCGAGAGTAGGTACACCATGAATACTAAAGAAGACAGCAAGGAGAACTGTTCAGGATGGGCAGCTCGAGATCCATCAGGTGTTTTGTCACCTTACCAATTTAACCGAAGAGTCACAGGCCTTGATGATATCTCATTAAAGATAACTCATTGTGGAGTTTGTTACGCCGATGTTGCATGGACCCGGAATAAACTTGGTGATTCAAAGTATGAAGCAGCTGATGGGTTTGCAGACATT

Fln Alignment:

biogeco3_mira_c22923___MNTKEDSKENCSGWAARDPSGVLSPYQFNRRVTGLDDISLKITHCGVCYADVAWTRNKLGDSKYEAADG
A9NK95__________________MNTKEDCKENCKGWAARDPSGVLSPYQFNRRVPGLDDISLKITHCGVCYADVVWTRNKHGDSKYPLVPG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain