|
||||||
|
UniGene Name: biog3_v1.0_unigene22758
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene22758
T |
|
Ace file of the UniGene biog3_v1.0_unigene22758 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene2882 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RIQ4_RICCO | - | - | 0.0 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Blast2go | p-loop containing nucleoside triphosphate hydrolase-like protein | - | - | 0.0 | 78% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 0.0 | 78% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | pollen sperm cell differentiation | GO:0048235 | Biological Process | 0.0 | 78% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 78% |
| Blast2go | microtubule-severing ATPase activity | GO:0008568 | Molecular Function | 0.0 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNH8
Fln msg: Distance to subject end: 202 aas, your sequence is shorter than subject: 75 - 336
Fln protein:
A
Protein Length:
76
Fln nts:
T
Fln Alignment:
biogeco3_mira_c21605___NDFEKRIRPEVIPAGEIGVNFSDIGALDNVKEALQELVMLPLRRPDLFK-GGLLKPCKGILLFGPPGTGKTI
B8LNH8__________________NQYEDVIACDVVNPDDIDVAFESIGGLDEIKQALHELVILPLQRPGLFSHGRLLGPQKGVLLYGPPGTGKTL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
