SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene21976

Length: 375 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene21976
AATGTATTTTGATCCACCCAATATTGTCGAATGGGCAGCACCCGTGATCAGCCAGGGAAAGGCAGCAGTCATCCTAGACCGCAGTGTGGATTTACCACGAAATGTGGAACCTTTGCTCAGAATGGCTGATATTGCAGAGCTTTCTGTTAGGCAAGACCCAAACGAAAGACCAACCATGTCAGACGTGGCTACGTGGTTGGAGCAACTCGTCAGAACTAGCTCTTAGTAGTATTGTTTTCTATCTACGATTGCGAGCATTCTTGACAAATTGAAGATTATTGCTTGAAAATTATTTTGCCTCGAGGGCAAAGCCAGCTACAATGTTTTTGTCTAAAATTCAAGTTCAAATAGCATCTCATCTACCTGGTATTTACA

Ace file of the UniGene biog3_v1.0_unigene21976 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene11500	2/3
SustainPine v2.0	sp_v2.0_unigene33202	1/3

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	37%
Blast2go	atp binding	-	-	9.6872e-32	79%

Source	ECs	Term	Type	e value	Identity
Blast2go	Cinnamoyl-CoA reductase.	EC:1.2.1.44	-	9.6872e-32	79%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Phenylpropanoid biosynthesis	00940		9.6872e-32	79%
Blast2go	Biosynthesis of phenylpropanoids	01061		9.6872e-32	79%
Blast2go	Metabolic pathways	01100		9.6872e-32	79%
Blast2go	Biosynthesis of secondary metabolites	01110		9.6872e-32	79%
Blast2go	Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases.	EC:2.7.11.-	-	9.6872e-32	79%

Source	GOs	Term	Type	e value	Identity
Blast2go	anther development	GO:0048653	Biological Process	9.6872e-32	79%
Blast2go	DNA duplex unwinding	GO:0032508	Biological Process	9.6872e-32	79%
Blast2go	carotenoid biosynthetic process	GO:0016117	Biological Process	9.6872e-32	79%
Blast2go	regulation of stomatal movement	GO:0010119	Biological Process	9.6872e-32	79%
Blast2go	etioplast organization	GO:0009662	Biological Process	9.6872e-32	79%
Blast2go	mRNA export from nucleus	GO:0006406	Biological Process	9.6872e-32	79%
Blast2go	regulation of plant-type hypersensitive response	GO:0010363	Biological Process	9.6872e-32	79%
Blast2go	negative regulation of flower development	GO:0009910	Biological Process	9.6872e-32	79%
Blast2go	response to salt stress	GO:0009651	Biological Process	9.6872e-32	79%
Blast2go	positive regulation of histone methylation	GO:0031062	Biological Process	9.6872e-32	79%
Blast2go	lignin biosynthetic process	GO:0009809	Biological Process	9.6872e-32	79%
Blast2go	response to zinc ion	GO:0010043	Biological Process	9.6872e-32	79%
Blast2go	protein phosphorylation	GO:0006468	Biological Process	9.6872e-32	79%
Blast2go	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	9.6872e-32	79%
Blast2go	pollen development	GO:0009555	Biological Process	9.6872e-32	79%
Blast2go	secondary shoot formation	GO:0010223	Biological Process	9.6872e-32	79%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	9.6872e-32	79%
Blast2go	embryo sac development	GO:0009553	Biological Process	9.6872e-32	79%
Blast2go	response to cold	GO:0009409	Biological Process	9.6872e-32	79%
Blast2go	response to abscisic acid stimulus	GO:0009737	Biological Process	9.6872e-32	79%
Blast2go	histone H3-K36 methylation	GO:0010452	Biological Process	9.6872e-32	79%
Blast2go	regulation of gene expression, epigenetic	GO:0040029	Biological Process	9.6872e-32	79%
Blast2go	ovule development	GO:0048481	Biological Process	9.6872e-32	79%
Blast2go	RNA secondary structure unwinding	GO:0010501	Biological Process	9.6872e-32	79%
Blast2go	circadian rhythm	GO:0007623	Biological Process	9.6872e-32	79%
Blast2go	histone methyltransferase activity (H3-K36 specific)	GO:0046975	Molecular Function	9.6872e-32	79%
Blast2go	single-stranded DNA binding	GO:0003697	Molecular Function	9.6872e-32	79%
Blast2go	cinnamoyl-CoA reductase activity	GO:0016621	Molecular Function	9.6872e-32	79%
Blast2go	protein serine/threonine kinase activity	GO:0004674	Molecular Function	9.6872e-32	79%
Blast2go	carotenoid isomerase activity	GO:0046608	Molecular Function	9.6872e-32	79%
Blast2go	RNA binding	GO:0003723	Molecular Function	9.6872e-32	79%
Blast2go	histone methyltransferase activity (H3-K4 specific)	GO:0042800	Molecular Function	9.6872e-32	79%
Blast2go	double-stranded DNA binding	GO:0003690	Molecular Function	9.6872e-32	79%
Blast2go	receptor activity	GO:0004872	Molecular Function	9.6872e-32	79%
Blast2go	protein homodimerization activity	GO:0042803	Molecular Function	9.6872e-32	79%
Blast2go	ATP binding	GO:0005524	Molecular Function	9.6872e-32	79%
Blast2go	chloroplast	GO:0009507	Cellular Component	9.6872e-32	79%
Blast2go	cell wall	GO:0005618	Cellular Component	9.6872e-32	79%
Blast2go	peroxisome	GO:0005777	Cellular Component	9.6872e-32	79%
Blast2go	nucleolus	GO:0005730	Cellular Component	9.6872e-32	79%
Blast2go	endomembrane system	GO:0012505	Cellular Component	9.6872e-32	79%
Blast2go	plasma membrane	GO:0005886	Cellular Component	9.6872e-32	79%

Source	InterPros	Term	Type	Identity
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	TNFR/CD27/30/40/95 cysteine-rich region	IPR001368	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Regulator of chromosome condensation/beta-lactamase-inhibitor protein II	IPR009091	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LRZ4

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 143 aas, your sequence is shorter than subject: 75 - 511

Fln protein: MYFDPPNIVEWAAPVISQGKAAVILDRSVDLPRNVEPLLRMADIAELSVRQDPNERPTMSDVATWLEQLVRTSS*

Protein Length: 76

Fln nts: AATGTATTTTGATCCACCCAATATTGTCGAATGGGCAGCACCCGTGATCAGCCAGGGAAAGGCAGCAGTCATCCTAGACCGCAGTGTGGATTTACCACGAAATGTGGAACCTTTGCTCAGAATGGCTGATATTGCAGAGCTTTCTGTTAGGCAAGACCCAAACGAAAGACCAACCATGTCAGACGTGGCTACGTGGTTGGAGCAACTCGTCAGAACTAGCTCTTAGTAGTATTGTTTTCTATCTACGATTGCGAGCATTCTTGACAAATTGAAGATTATTGCTTGAAAATTATTTTGCCTCGAGGGCAAAGCCAGCTACAATGTTTTTGTCTAAAATTCAAGTTCAAATAGCATCTCATCTACCTGGTATTTACA

Fln Alignment:

biogeco3_mira_c20450___FDPPNIVEWAAPVISQGKAAVILDRSVDLPRNVEPLLRMADIAELSVRQDPNERPTMSDVATWLEQLVRT
B8LRZ4__________________YSPPSIVDWAMPLIRQNKILELYDPRLSPPKNLNTIKHMALIAARCVRSTEERRPSMNEVVEGLKQVSRS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain