|
||||||
|
UniGene Name: biog3_v1.0_unigene20892
Length: 232 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene20892
A |
|
Ace file of the UniGene biog3_v1.0_unigene20892
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene42414 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Retrotransposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLK1_ORYSJ | - | - | 1.0e-35 | 49% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 40% |
| Blast2go | retrotransposon unclassified | - | - | 2.18061e-35 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 76 - 407
Fln protein:
C
Protein Length:
77
Fln nts:
A
Fln Alignment:
biogeco3_mira_c18867___KRTKLDSRSLNCTMIGYSDEKKGYRLL--TNGKFIVNRDVIFDE-----TESKNAEEIESLL
B8LKX7__________________KRKKLDRKSHKCIMVGYSETSKAYRVYDPEKNEILIRRDVIFDERCIPSTKSSSLSPTSSIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
