UniGene Name: biog3_v1.0_unigene19817
Length: 239 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19817
T |
Ace file of the UniGene biog3_v1.0_unigene19817 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene36813 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RTY5_RICCO | - | - | 0.0 | 78% |
| FL-Next | Isoform 2 of ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM | - | - | 0.0 | 54% |
| Blast2go | chromatin remodeling complex subunit | - | - | 0.0 | 91% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 91% |
| Blast2go | response to salt stress | GO:0009651 | Biological Process | 0.0 | 91% |
| Blast2go | response to heat | GO:0009408 | Biological Process | 0.0 | 91% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 91% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
| Sma3 | HMG-I/HMG-Y, DNA-binding, conserved site | IPR000637 | - | 0.0 | - |
| Sma3 | IPR000910 | - | 0.0 | - | |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Bromodomain | IPR001487 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | HSA | IPR006562 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1086 | IPR009462 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1087 | IPR009463 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | HAS subgroup | IPR013999 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | Helicase/SANT-associated, DNA binding | IPR014012 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Glutamine-Leucine-Glutamine, QLQ | IPR014978 | - | 0.0 | - |
| Sma3 | ATPase, nucleosome remodelling ISWI, HAND domain | IPR015194 | - | 0.0 | - |
| Sma3 | SLIDE domain | IPR015195 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | SANT domain | IPR017884 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
| Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
| Sma3 | Bromodomain, conserved site | IPR018359 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q6EVK6-2
Fln msg: Distance to subject end: 1032 aas, your sequence is shorter than subject: 79 - 2192
Fln protein:
L
Protein Length:
80
Fln nts:
T
Fln Alignment:
biogeco3_mira_c17300___LITHYDLIMRDKAYLKKIHWHYMIVDEGHRLKNHECALARTLVTGYRIRRRLLLTGTPIQNSLQELWALLNFLLQSIFN
Q6EVK6-2________________LVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDL-DRYRCQRRLLLTGTPLQNDLKELWSLLNLLLPDVFD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)