|
||||||
|
UniGene Name: biog3_v1.0_unigene19476
Length: 142 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene19476
A |
|
Ace file of the UniGene biog3_v1.0_unigene19476
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene984 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SBD4_RICCO | - | - | 0.0 | 55% |
| FL-Next | sp=Bifunctional fucokinase/fucose pyrophosphorylase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 60% |
| Blast2go | bifunctional fucokinase fucose pyrophosphorylase-like | - | - | 0.0 | 74% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fucokinase. | EC:2.7.1.52 | - | 0.0 | 74% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fructose and mannose metabolism | 00051 | 0.0 | 74% | |
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 74% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 74% | |
| Blast2go | EC:2.7.7.3- | - | 0.0 | 74% | |
| Blast2go | Galactokinase. | EC:2.7.1.6 | - | 0.0 | 74% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Galactose metabolism | 00052 | 0.0 | 74% | |
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 74% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 74% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | GDP-L-fucose salvage | GO:0042352 | Biological Process | 0.0 | 74% |
| Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 74% |
| Blast2go | fucokinase activity | GO:0050201 | Molecular Function | 0.0 | 74% |
| Blast2go | fucose-1-phosphate guanylyltransferase activity | GO:0047341 | Molecular Function | 0.0 | 74% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 74% |
| Blast2go | galactokinase activity | GO:0004335 | Molecular Function | 0.0 | 74% |
| Blast2go | cytoplasm | GO:0005737 | Cellular Component | 0.0 | 74% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F0 complex, subunit A | IPR000568 | - | 0.0 | - |
| Sma3 | Galactokinase/homoserine kinase | IPR001174 | - | 0.0 | - |
| Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | GHMP kinase N-terminal domain | IPR006204 | - | 0.0 | - |
| Sma3 | Mevalonate/galactokinase | IPR006206 | - | 0.0 | - |
| Sma3 | L-fucokinase | IPR012887 | - | 0.0 | - |
| Sma3 | GHMP kinase, C-terminal domain | IPR013750 | - | 0.0 | - |
| Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LNJ9
Fln msg: Distance to subject end: 577 aas, your sequence is shorter than subject: 46 - 1055
Fln protein:
C
Protein Length:
47
Fln nts:
A
Fln Alignment:
biogeco3_mira_c16825___HIDQERRVYKENGPFLVLPDRHCLWEVPLVGDTGRVILCCGIEDN
Q9LNJ9__________________HIPSEDLGTPESFRFM-LPDRHCLWEVPLVGHKGRVIVYCGLHDN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
