|
||||||
|
UniGene Name: biog3_v1.0_unigene19275
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19275
G |
|
Ace file of the UniGene biog3_v1.0_unigene19275 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene14979 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative receptor-like protein kinase [Arabidopsis thaliana] | - | - | 0.0 | 69% |
| FL-Next | sp=LRR receptor-like serine/threonine-protein kinase FEI 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 59% |
| Blast2go | brassinosteroid insensitive 1-associated receptor kinase 1 | - | - | 0.0 | 85% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | 85% |
| Blast2go | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | 85% |
| Blast2go | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | 85% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: sp_plants
Fln subject: C0LGL9
Fln msg: your sequence is shorter than subject: 48 - 589
Fln protein:
M
Protein Length:
49
Fln nts:
G
Fln Alignment:
biogeco3_mira_c16562___MEAVLQIIVRCIASSPEERPTMNQVVQMLEAETMSPCPSDFYVSNSE
C0LGL9__________________LDALLSIATKCVSSSPDERPTMHRVVQLLESEVMTPCPSDFYDSSSD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
