|
||||||
|
UniGene Name: biog3_v1.0_unigene17656
Length: 164 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene17656
A |
|
Ace file of the UniGene biog3_v1.0_unigene17656
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1529 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gb|AAC97224.1| putative helicase [Arabidopsis thaliana] gb|AAL24339.1| SNF2/RAD54 family (ETL1 subfamily) protein [Arabidopsis thaliana] gb|AAO00936.1| SNF2/RAD54 family (ETL1 subfamily) p | - | - | 0.0 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 63% |
| Blast2go | snf2 family dna-dependent atpase | - | - | 0.0 | 79% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 79% |
| Blast2go | helicase activity | GO:0004386 | Molecular Function | 0.0 | 79% |
| Blast2go | DNA binding | GO:0003677 | Molecular Function | 0.0 | 79% |
| Blast2go | transferase activity | GO:0016740 | Molecular Function | 0.0 | 79% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 79% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR003016 | - | 0.0 | - |
| Sma3 | HSA | IPR006562 | - | 0.0 | - |
| Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | Vps54-like | IPR012501 | - | 0.0 | - |
| Sma3 | HAS subgroup | IPR013999 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | Helicase/SANT-associated, DNA binding | IPR014012 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | ATPase, nucleosome remodelling ISWI, HAND domain | IPR015194 | - | 0.0 | - |
| Sma3 | SLIDE domain | IPR015195 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | SANT domain | IPR017884 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Sma3 | Isocitrate lyase/phosphorylmutase, conserved site | IPR018523 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7TAI9
Fln msg: Overlapping hits, possible frame ERROR between 117 and 102, and overlapping frame ERROR between 137 and 113, Distance to subject end: 314 aas, your sequence is shorter than subject: 55 - 728
Fln protein:
N
Protein Length:
56
Fln nts:
A
Fln Alignment:
biogeco3_mira_c14322___VEFMMPNIFETGDVDLKKVLSASAEDTNLIARIxxxxxxxxxxxxKSDVMQQLV
D7TAI9__________________LEFMMPDLFTTGDVDLKKLL--NAEDRDLIARMxxxxxxxxxxxxKSDVMQQLV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
