|
||||||
|
UniGene Name: biog3_v1.0_unigene16832
Length: 240 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene16832
A |
|
Ace file of the UniGene biog3_v1.0_unigene16832
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3228 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | LRR receptor-like serine/threonine-protein kinase RPK2 [Arabidopsis thaliana] sp|Q9S7I6.1|RPK2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase RPK2; AltName: Full=Protein TOADSTOOL 2; AltName: Full=Receptor-like protein kinase 2; Fla | - | - | 0.0 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 47% |
| Blast2go | lrr receptor-like serine threonine-protein kinase rpk2-like | - | - | 0.0 | 81% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 81% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 81% |
| Blast2go | radial axis specification | GO:0009945 | Biological Process | 0.0 | 81% |
| Blast2go | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | 81% |
| Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 81% |
| Blast2go | response to cold | GO:0009409 | Biological Process | 0.0 | 81% |
| Blast2go | protein homooligomerization | GO:0051260 | Biological Process | 0.0 | 81% |
| Blast2go | transmembrane receptor protein tyrosine kinase signaling pathway | GO:0007169 | Biological Process | 0.0 | 81% |
| Blast2go | embryonic meristem development | GO:0048508 | Biological Process | 0.0 | 81% |
| Blast2go | meristem maintenance | GO:0010073 | Biological Process | 0.0 | 81% |
| Blast2go | lignin metabolic process | GO:0009808 | Biological Process | 0.0 | 81% |
| Blast2go | pollen maturation | GO:0010152 | Biological Process | 0.0 | 81% |
| Blast2go | anther development | GO:0048653 | Biological Process | 0.0 | 81% |
| Blast2go | pollen germination | GO:0009846 | Biological Process | 0.0 | 81% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 81% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 81% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 81% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 81% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 81% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5ATJ4
Fln msg: Distance to subject end: 285 aas, your sequence is shorter than subject: 79 - 1050
Fln protein:
M
Protein Length:
80
Fln nts:
A
Fln Alignment:
biogeco3_mira_c13125___GSRRDPSDSNS-LEIAAITSASVITFLVVAFXXXXXXXXXXXPKPP-GPRSGRKEVVTFNNIGIQLSYEKV
A5ATJ4__________________GSRSRKSDMFSPIEIASITSASIIVFVLIALVLLYVSMKKFVCHTVLGQGSGKKEVVTCNNIGVQLTYENV
| SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 120 | 132 | TTA TTA TTA TTA T | 13 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
