|
||||||
|
UniGene Name: biog3_v1.0_unigene16784
Length: 106 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene16784
A |
|
Ace file of the UniGene biog3_v1.0_unigene16784
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1321 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative respiratory burst oxidase [Oryza sativa Japonica Group] | - | - | 0.0 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Blast2go | respiratory burst oxidase homolog protein h-like | - | - | 0.0 | 78% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Peroxidase. | EC:1.11.1.7 | - | 0.0 | 78% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 78% | |
| Blast2go | Methane metabolism | 00680 | 0.0 | 78% | |
| Blast2go | Phenylpropanoid biosynthesis | 00940 | 0.0 | 78% | |
| Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 78% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 78% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 78% | |
| Blast2go | Oxidoreductases, Acting on NADH or NADPH, With a oxygen as acceptor. | EC:1.6.3.- | - | 0.0 | 78% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | electron transport chain | GO:0022900 | Biological Process | 0.0 | 78% |
| Blast2go | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | 78% |
| Blast2go | iron ion binding | GO:0005506 | Molecular Function | 0.0 | 78% |
| Blast2go | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | 78% |
| Blast2go | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | 78% |
| Blast2go | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | 78% |
| Blast2go | oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor | GO:0050664 | Molecular Function | 0.0 | 78% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 78% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome b245, heavy chain | IPR000778 | - | 0.0 | - |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | FAD-binding 8 | IPR013112 | - | 0.0 | - |
| Sma3 | Ferric reductase, NAD binding | IPR013121 | - | 0.0 | - |
| Sma3 | Flavoprotein transmembrane component | IPR013130 | - | 0.0 | - |
| Sma3 | NADPH oxidase Respiratory burst | IPR013623 | - | 0.0 | - |
| Sma3 | Ferredoxin reductase-type FAD-binding domain | IPR017927 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABF5
Fln msg: Distance to subject end: 89 aas, your sequence is shorter than subject: 34 - 358
Fln protein:
G
Protein Length:
35
Fln nts:
A
Fln Alignment:
biogeco3_mira_c13058___GSFEWFKGVMNEVAESDHNRVIEMHNYLTSVYEE
D5ABF5__________________GSFDWFKGVMNEVAEIDQKGIIELHNYCTSVYEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
