UniGene Name: biog3_v1.0_unigene15133
Length: 241 nt
UniGene Fasta
|
|---|
| >biog3_v1.0_unigene15133
G |
Ace file of the UniGene biog3_v1.0_unigene15133
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3099 | 4/4 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | AAA-type ATPase family protein [Arabidopsis thaliana] gb|AED97923.1| AAA-type ATPase family protein [Arabidopsis thaliana] | - | - | 0.0 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 71% |
| Blast2go | aaa-type atpase family protein | - | - | 0.0 | 75% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Hydrolases, Acting on peptide bonds (peptide hydrolases), Metalloendopeptidases. | EC:3.4.24.- | - | 0.0 | 75% |
| Blast2go | Adenosinetriphosphatase. | EC:3.6.1.3 | - | 0.0 | 75% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 75% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | proteolysis | GO:0006508 | Biological Process | 0.0 | 75% |
| Blast2go | embryo development | GO:0009790 | Biological Process | 0.0 | 75% |
| Blast2go | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | 75% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 75% |
| Blast2go | ATPase activity | GO:0016887 | Molecular Function | 0.0 | 75% |
| Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6I0F3
Fln msg: Distance to subject end: 230 aas, your sequence is shorter than subject: 80 - 768
Fln protein:
E
Protein Length:
81
Fln nts:
G
Fln Alignment:
biogeco3_mira_c9862___DYIEKEELIEALKRQEGTFSTGQEDHVEIPLELKLRLAYREAAIAILECYYPNPHRPFIKTDIRMVDSQPNMQY
F6I0F3__________________DYIGREELLEALKRQKGTFETGQEDSTEIPEELKLRLAYREAAVAVLACYFPDPYRPFIETNINSIHSQPNMRY
SNPs (tot: 7) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 28 | 66 | 33 | 0.997471 | ||
| 121 | 25 | 75 | 0.996473 | ||
| 175 | 25 | 75 | 0.996473 | ||
| 177 | 25 | 75 | 0.996473 | ||
| 234 | 33 | 66 | 0.997453 | ||
| 236 | 33 | 33 | 33 | 0.99775 | |
| 237 | 33 | 33 | 33 | 0.99775 |

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta