UniGene Name: biog3_v1.0_unigene15055
Length: 190 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene15055
C |
Ace file of the UniGene biog3_v1.0_unigene15055 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6209 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | xanthine dehydrogenase 1 [Arabidopsis thaliana] gb|AAO11781.1| xanthine dehydrogenase 1 [Arabidopsis thaliana] gb|AEE86434.1| xanthine dehydrogenase 1 [Arabidopsis thaliana] | - | - | 0.0 | 68% |
| FL-Next | sp=Probable aldehyde oxidase 2; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 56% |
| Blast2go | xanthine dehydrogenase 1 | - | - | 0.0 | 86% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Xanthine oxidase. | EC:1.17.3.2 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 86% | |
| Blast2go | Caffeine metabolism | 00232 | 0.0 | 86% | |
| Blast2go | Drug metabolism - other enzymes | 00983 | 0.0 | 86% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 86% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 86% | |
| Blast2go | Xanthine dehydrogenase. | EC:1.17.1.4 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 86% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 86% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 86% |
| Blast2go | superoxide anion generation | GO:0042554 | Biological Process | 0.0 | 86% |
| Blast2go | purine base catabolic process | GO:0006145 | Biological Process | 0.0 | 86% |
| Blast2go | xanthine metabolic process | GO:0046110 | Biological Process | 0.0 | 86% |
| Blast2go | response to reactive oxygen species | GO:0000302 | Biological Process | 0.0 | 86% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 86% |
| Blast2go | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | 86% |
| Blast2go | xanthine oxidase activity | GO:0004855 | Molecular Function | 0.0 | 86% |
| Blast2go | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | 86% |
| Blast2go | iron ion binding | GO:0005506 | Molecular Function | 0.0 | 86% |
| Blast2go | xanthine dehydrogenase activity | GO:0004854 | Molecular Function | 0.0 | 86% |
| Blast2go | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | 86% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead | IPR000674 | - | 0.0 | - |
| Sma3 | 2Fe-2S ferredoxin-type domain | IPR001041 | - | 0.0 | - |
| Sma3 | Molybdopterin dehydrogenase, FAD-binding | IPR002346 | - | 0.0 | - |
| Sma3 | [2Fe-2S]-binding | IPR002888 | - | 0.0 | - |
| Sma3 | CO dehydrogenase flavoprotein, C-terminal | IPR005107 | - | 0.0 | - |
| Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding | IPR008274 | - | 0.0 | - |
| Sma3 | Beta-grasp domain | IPR012675 | - | 0.0 | - |
| Sma3 | Xanthine dehydrogenase, small subunit | IPR014307 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
| Sma3 | CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 | IPR016169 | - | 0.0 | - |
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase | IPR016208 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q852M1
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 115 aas, your sequence is shorter than subject: 61 - 1355
Fln protein:
P
Protein Length:
62
Fln nts:
C
Fln Alignment:
biogeco3_mira_c9588___NYFTFGAAFAEVEVDTLTGDFHLREVDIVMDLGNSLNPAIDIGQVEGGFIQGL
Q852M1__________________SYLNYGAAISEVEVDVLTGETTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGI
SNPs (tot: 1) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 70 | 33 | 66 | 0.997454 |

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)