SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene15032

Length: 473 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene15032
CCTCGGACTTTGCCCTTCCAGCCAGCTGCGACGCCAAACGTCTCTGTCATTTCACGTGCGCATACGCTGATAGCACGGACGTGGAGGGAAACCTCGCCAGCGATGTGGTTAGCCTTCTGCCTTCGAACACAAGGGCAACTGCTCTCCGAATTCCCGGCTTGGTGCTCGGTTGCGCCTCCTCGGCCCTGGCCGGCACGCCGGCTTTGATGGGTCTCAACCGTGGTGCTTTATCCTTCGTTTCTCAACTGCGAACCCTCAATATTCCGCCCAAATTCTCATACTGTATTGCCGATCGTTTCCATTCTCCGGATTCTCCAGGACTCCTTTACTTCGGAAATTCTCCTTTTGCCAAATATCTGCACTACACGCAACAGTTCACAATAGCACTTCCGCTACCGTATTTCAACAGAGCAGCCTACAGCGTTAGGCTAGAGAGCATCAAGGTTGGAAACAGCTTCTCCCCATCCCCAAGT

Ace file of the UniGene biog3_v1.0_unigene15032 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene2051	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	aspartyl protease family protein [Arabidopsis thaliana] emb\|CAB82992.1\| putative protein [Arabidopsis thaliana] gb\|AAT85726.1\| At5g02190 [Arabidopsis thaliana] gb\|AAU94418.1\| At5g02190 [Arabidopsis thaliana] dbj\|BAE99007.1\| hypothetical protein [Arabidops	-	-	46%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	33%
Blast2go	aspartic proteinase nepenthesin-2-like	-	-	62%

Source	ECs	Term	Type	e value	Identity
Blast2go	Arsenite-transporting ATPase.	EC:3.6.3.16	-	0.0	62%
Blast2go	Glutathione gamma-glutamylcysteinyltransferase.	EC:2.3.2.15	-	0.0	62%

Source	GOs	Term	Type	Identity
Blast2go	arsenite transport	GO:0015700	Biological Process	62%
Blast2go	embryo development ending in seed dormancy	GO:0009793	Biological Process	62%
Blast2go	programmed cell death	GO:0012501	Biological Process	62%
Blast2go	indole glucosinolate catabolic process	GO:0042344	Biological Process	62%
Blast2go	phytochelatin biosynthetic process	GO:0046938	Biological Process	62%
Blast2go	defense response by callose deposition in cell wall	GO:0052544	Biological Process	62%
Blast2go	response to arsenic-containing substance	GO:0046685	Biological Process	62%
Blast2go	defense response to bacterium	GO:0042742	Biological Process	62%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	62%
Blast2go	cadmium ion binding	GO:0046870	Molecular Function	62%
Blast2go	arsenite-transmembrane transporting ATPase activity	GO:0015446	Molecular Function	62%
Blast2go	peptidase activity	GO:0008233	Molecular Function	62%
Blast2go	copper ion binding	GO:0005507	Molecular Function	62%
Blast2go	glutathione gamma-glutamylcysteinyltransferase activity	GO:0016756	Molecular Function	62%
Blast2go	cytosol	GO:0005829	Cellular Component	62%
Blast2go	endoplasmic reticulum	GO:0005783	Cellular Component	62%
Blast2go	phytochelatin transmembrane transporter activity	GO:0071992	Biological Process	62%
Blast2go	phytochelatin transmembrane transport	GO:0071994	Biological Process	62%

Source	InterPros	Term	Type	Identity
Sma3	Peptidase A1	IPR001461	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PSK0

Fln msg: Distance to subject end: 132 aas, your sequence is shorter than subject: 157 - 452

Fln protein: SDFALPASCDAKRLCHFTCAYADSTDVEGNLASDVVSLLPSNTRATALRIPGLVLGCASSALAGTPALMGLNRGALSFVSQLRTLNIPPKFSYCIADRFHSPDSPGLLYFGNSPFAKYLHYTQQFTIALPLPYFNRAAYSVRLESIKVGNSFSPSPS

Protein Length: 158

Fln nts: CCTCGGACTTTGCCCTTCCAGCCAGCTGCGACGCCAAACGTCTCTGTCATTTCACGTGCGCATACGCTGATAGCACGGACGTGGAGGGAAACCTCGCCAGCGATGTGGTTAGCCTTCTGCCTTCGAACACAAGGGCAACTGCTCTCCGAATTCCCGGCTTGGTGCTCGGTTGCGCCTCCTCGGCCCTGGCCGGCACGCCGGCTTTGATGGGTCTCAACCGTGGTGCTTTATCCTTCGTTTCTCAACTGCGAACCCTCAATATTCCGCCCAAATTCTCATACTGTATTGCCGATCGTTTCCATTCTCCGGATTCTCCAGGACTCCTTTACTTCGGAAATTCTCCTTTTGCCAAATATCTGCACTACACGCAACAGTTCACAATAGCACTTCCGCTACCGTATTTCAACAGAGCAGCCTACAGCGTTAGGCTAGAGAGCATCAAGGTTGGAAACAGCTTCTCCCCATCCCCAAGT

Fln Alignment:

biogeco3_mira_c9505___LPASCDAKRLCHFTCAYADSTDVEGNLASDVVSLLPSNTRATALRIPGLVLGCASSALAGT---PALMGLNRGALSFVSQLRTLNI-PPKFSYCIADRFHSPDSPGLLYFGNSPFAKYLHYTQQFTIALPLPYFNRAAYSVRLESIKVGNS
C0PSK0__________________ISGNCGGNSKCQFEVLYGDGTQVDGTLASDAITL-------GSQYLPNFSFGCAESLSEDTYSSPGLMGLGGGSLSLLTQAPTAELFGGTFSYCLPS---SSTSSGSLVLGKE--AAVSSSSLKFTTLIKDPSF-PTFYFVTLKAISVGNT

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
228	33		66		0.997452
230			33	66	0.997452
231			66	33	0.997452
248	33		66		0.997452
250	66	33			0.997452
283		33	66		0.997452
301	33		66		0.997452
331	66	33			0.997456

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain