SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene9535

Length: 327 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>biog3_v1.0_unigene9535
TTGTAGACCTGTTACGAAATGATCTTGGCCGTTGTGTGTGAACCTGGAACTGTACATGTACCCAATCTTATGGATGTGGAATCTTATGCAACAGTTCATACATTAGTAAGCACCATCAGAGGGAAGAAAAAAGATAACGTGAGCCCTGTAGAGTGTGTGAGAGCTGCATTTCCAGGAGGTTCAATGACTGGAGCACCGAAACTAAGAGCAATGGAGATTCTTGACTCTATTGAGAATACTTCTAGGGGAGTTTACTCTGGGACAATAGGTTTTTTCTCCTTCAATCACACATTTGATTTGAATATTGTTATTAGAACAATTTACATT

Ace file of the UniGene biog3_v1.0_unigene9535 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene6018	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	4-amino-4-deoxychorismate synthase n=2 Tax=Triticeae RepID=A4UIY9_WHEAT	-	-	48%
FL-Next	sp=Anthranilate synthase component I-2, chloroplastic; Arabidopsis thaliana (Mouse-ear cress).	-	-	40%
Blast2go	para-aminobenzoate synthase-like	-	-	78%

Source	ECs	Term	Type	e value	Identity
Blast2go	Anthranilate synthase.	EC:4.1.3.27	-	0.0	78%

Source	KEGGs	Term	Type	Identity
Blast2go	Phenylalanine, tyrosine and tryptophan biosynthesis	00400		78%
Blast2go	Biosynthesis of phenylpropanoids	01061		78%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063		78%
Blast2go	Biosynthesis of plant hormones	01070		78%
Blast2go	Metabolic pathways	01100		78%
Blast2go	Biosynthesis of secondary metabolites	01110		78%
Blast2go	Aminodeoxychorismate synthase.	EC:2.6.1.85	-	78%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Folate biosynthesis	00790		0.0	78%
Blast2go	Biosynthesis of phenylpropanoids	01061		0.0	78%

Source	GOs	Term	Type	Identity
Blast2go	glutamine metabolic process	GO:0006541	Biological Process	78%
Blast2go	folic acid biosynthetic process	GO:0046656	Biological Process	78%
Blast2go	para-aminobenzoic acid biosynthetic process	GO:0008153	Biological Process	78%
Blast2go	chorismate metabolic process	GO:0046417	Biological Process	78%
Blast2go	embryo development ending in seed dormancy	GO:0009793	Biological Process	78%
Blast2go	anthranilate synthase activity	GO:0004049	Molecular Function	78%
Blast2go	4-amino-4-deoxychorismate synthase activity	GO:0046820	Molecular Function	78%
Blast2go	chloroplast	GO:0009507	Cellular Component	78%

Source	InterPros	Term	Type	Identity
Sma3	NUDIX hydrolase, NudL, conserved site	IPR000059	-	-
Sma3	NUDIX hydrolase domain	IPR000086	-	-
Sma3		IPR000991	-	-
Sma3		IPR001317	-	-
Sma3	Ribonuclease A	IPR001427	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	ADC synthase	IPR005801	-	-
Sma3	Para-aminobenzoate synthase, component I	IPR005802	-	-
Sma3		IPR006220	-	-
Sma3	Anthranilate synthase, glutamine amidotransferase	IPR006221	-	-
Sma3	Anthranilate synthase component I, N-terminal	IPR006805	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3		IPR011702	-	-
Sma3	Chorismate binding, C-terminal	IPR015890	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Glutamine amidotransferase type 1	IPR017926	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: P32069

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 78 aas, your sequence is shorter than subject: 109 - 621

Fln protein: L*TCYEMILAVVCEPGTVHVPNLMDVESYATVHTLVSTIRGKKKDNVSPVECVRAAFPGGSMTGAPKLRAMEILDSIENTSRGVYSGTIGFFSFNHTFDLNIVIRTIYI

Protein Length: 110

Fln nts: TTGTAGACCTGTTACGAAATGATCTTGGCCGTTGTGTGTGAACCTGGAACTGTACATGTACCCAATCTTATGGATGTGGAATCTTATGCAACAGTTCATACATTAGTAAGCACCATCAGAGGGAAGAAAAAAGATAACGTGAGCCCTGTAGAGTGTGTGAGAGCTGCATTTCCAGGAGGTTCAATGACTGGAGCACCGAAACTAAGAGCAATGGAGATTCTTGACTCTATTGAGAATACTTCTAGGGGAGTTTACTCTGGGACAATAGGTTTTTTCTCCTTCAATCACACATTTGATTTGAATATTGTTATTAGAACAATTTACATT

Fln Alignment:

Contig9535___VCEPGTVHVPNLMDVESYATVHTLVSTIRGKKKDNVSPVECVRAAFPGGSMTGAPKLRAMEILDSIENTSRGVYSGTIGFFSFNHTFDLNIVIRTI
P32069_________________VSKPGSVEVKKLKDIEWFSHVMHISSTVVGELLDHLTSWDALRAVLPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFNGDMDIALALRTM

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain