SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene8912

Length: 322 nt

UniGene Fasta

>biog3_v1.0_unigene8912
AATGTCTTGTTTCTAACTTTTTTTATGAGGCAAAAGTCTCCTGTAATGTTAACTTTAACCTTGCACCCTTGAAACTGGTTCTTGTGGGTTTTTCATTTCACAGGTCGAATTCTGGTCCGAGTTCGAATCGAGTCGAGGCAATGGGGCAAGCGCATGGCGGTGGCCTGAATCGCAGGGGCTCCCCAGACGACCGCAGGCAGGACGACAAGAAGGAGAAGAAATTCGAACCCGCAGCACCACCAACTCGCGTGGGCCGTAAACAAAGAAAGCAGAAGGGACCCGAGGCAGACAACAGGATGAGGCCTGCCAAATGCATGCCAGC

Ace file of the UniGene biog3_v1.0_unigene8912

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene28014	3/4
SustainPine v2.0	sp_v2.0_unigene63746	1/4

Source	Descriptions	Term	Type	Identity
AutoFact	AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula] gb\|ABN08912.1\| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]	-	-	88%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	88%
Blast2go	protein	-	-	95%

Source	ECs	Term	Type	e value	Identity
Blast2go	Adenosinetriphosphatase.	EC:3.6.1.3	-	0.0	95%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Purine metabolism	00230		0.0	95%

Source	GOs	Term	Type	Identity
Blast2go	proteasomal ubiquitin-dependent protein catabolic process	GO:0043161	Biological Process	95%
Blast2go	response to misfolded protein	GO:0051788	Biological Process	95%
Blast2go	meristem structural organization	GO:0009933	Biological Process	95%
Blast2go	leaf morphogenesis	GO:0009965	Biological Process	95%
Blast2go	proteasome core complex assembly	GO:0080129	Biological Process	95%
Blast2go	response to heat	GO:0009408	Biological Process	95%
Blast2go	root cap development	GO:0048829	Biological Process	95%
Blast2go	meristem growth	GO:0035266	Biological Process	95%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	95%
Blast2go	maintenance of root meristem identity	GO:0010078	Biological Process	95%
Blast2go	lateral root primordium development	GO:0010386	Biological Process	95%
Blast2go	ATPase activity	GO:0016887	Molecular Function	95%
Blast2go	proteasome regulatory particle, base subcomplex	GO:0008540	Cellular Component	95%
Blast2go	plasma membrane	GO:0005886	Cellular Component	95%

Source	InterPros	Term	Type	Identity
Sma3	26S proteasome subunit P45	IPR005937	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	ATPase, AAA-type, conserved site	IPR003960	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LKT7

Fln msg: Distance to subject end: 383 aas, your sequence is shorter than subject: 60 - 444

Fln protein: MGQAHGGGLNRRGSPDDRRQDDKKEKKFEPAAPPTRVGRKQRKQKGPEADNRMRPAKCMP

Protein Length: 61

Fln nts: AATGTCTTGTTTCTAACTTTTTTTATGAGGCAAAAGTCTCCTGTAATGTTAACTTTAACCTTGCACCCTTGAAACTGGTTCTTGTGGGTTTTTCATTTCACAGGTCGAATTCTGGTCCGAGTTCGAATCGAGTCGAGGCA_-_ATGGGGCAAGCGCATGGCGGTGGCCTGAATCGCAGGGGCTCCCCAGACGACCGCAGGCAGGACGACAAGAAGGAGAAGAAATTCGAACCCGCAGCACCACCAACTCGCGTGGGCCGTAAACAAAGAAAGCAGAAGGGACCCGAGGCAGACAACAGGATGAGGCCTGCCAAATGCATGCCAGC

Fln Alignment:

Contig8912___MGQAHGGGLNRRGSPXXXXXXXXXXXXXXXXXXXTRVGRKQRKQKGPEADNRM
B8LKT7_________________MGQAHGGGLNRKGSPDDRKQDDKKEKKFEPAAPPTRVGRRQRKQKGPEAAARL

SNPs (tot: 17)

Position	A %	C %	G %	T %	Probability
76			33	66	0.997452
77			66	33	0.997452
92			25	75	0.996473
93			25	75	0.996473
155		20		80	0.995493
175	20		80		0.995493
181		80		20	0.995493
196	20		80		0.995493
234			66	33	0.997452
246	33	66			0.997452
282	33		66		0.997452
284	33		66		0.997452
285	33		66		0.997452
286	33			33	0.997753
288	33	33	33		0.997753
289			66	33	0.997452
290	33	33		33	0.997753

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain