SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene8767

Length: 283 nt

UniGene Fasta

>biog3_v1.0_unigene8767
AATGTGGATTGTTATGTCAAGAACTTTGAATCTACCTGAAGATGCAAATCTTTGGGATGTATCTTCTACTCAAACTATAGTAGCAACACAAAGGGGAGCTCGTAGGGACTTTCAAAGGAGACTCGCATCGAAAGGTGTGGAAGTTGTGGAATTCGACATTCTAACACCAAGAGCTGTCATGGATTACTGCTATGACAGAGGCTTTCTTTCTGTATTATGGGAGTGCGGAGGGGCTTTGTCGGCCCCAGCTATTGCATTTGGTGTTATTCACAAGGTGATTGCC

Ace file of the UniGene biog3_v1.0_unigene8767

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene11	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	putative riboflavin biosynthesis protein ribD [Oryza sativa Japonica Group] dbj\|BAD21976.1\| putative riboflavin biosynthesis protein ribD [Oryza sativa Japonica Group]	-	-	62%
FL-Next	tr=Predicted protein; Physcomitrella patens subsp. patens (Moss).	-	-	81%
Blast2go	protein	-	-	79%

Source	ECs	Term	Type	e value	Identity
Blast2go	5-amino-6-(5-phosphoribosylamino)uracil reductase.	EC:1.1.1.193	-	0.0	79%

Source	KEGGs	Term	Type	Identity
Blast2go	Riboflavin metabolism	00740		79%
Blast2go	Metabolic pathways	01100		79%
Blast2go	Diaminohydroxyphosphoribosylaminopyrimidine deaminase.	EC:3.5.4.26	-	79%

Source	KEGGs	Term	Type	Identity
Blast2go	Riboflavin metabolism	00740		79%
Blast2go	Metabolic pathways	01100		79%
Blast2go	Phosphorylase.	EC:2.4.1.1	-	79%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Starch and sucrose metabolism	00500		0.0	79%

Source	GOs	Term	Type	Identity
Blast2go	FAD metabolic process	GO:0046443	Biological Process	79%
Blast2go	oxidation-reduction process	GO:0055114	Biological Process	79%
Blast2go	response to water deprivation	GO:0009414	Biological Process	79%
Blast2go	regulation of gene expression	GO:0010468	Biological Process	79%
Blast2go	response to temperature stimulus	GO:0009266	Biological Process	79%
Blast2go	regulation of stomatal movement	GO:0010119	Biological Process	79%
Blast2go	chloroplast organization	GO:0009658	Biological Process	79%
Blast2go	riboflavin biosynthetic process	GO:0009231	Biological Process	79%
Blast2go	cortical microtubule organization	GO:0043622	Biological Process	79%
Blast2go	response to abscisic acid stimulus	GO:0009737	Biological Process	79%
Blast2go	synapsis	GO:0007129	Biological Process	79%
Blast2go	response to high light intensity	GO:0009644	Biological Process	79%
Blast2go	zinc ion binding	GO:0008270	Molecular Function	79%
Blast2go	5-amino-6-(5-phosphoribosylamino)uracil reductase activity	GO:0008703	Molecular Function	79%
Blast2go	protein tyrosine/serine/threonine phosphatase activity	GO:0008138	Molecular Function	79%
Blast2go	diaminohydroxyphosphoribosylaminopyrimidine deaminase activity	GO:0008835	Molecular Function	79%
Blast2go	protein binding	GO:0005515	Molecular Function	79%
Blast2go	phosphorylase activity	GO:0004645	Molecular Function	79%
Blast2go	NADP binding	GO:0050661	Molecular Function	79%
Blast2go	mitochondrion	GO:0005739	Cellular Component	79%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	79%

Source	InterPros	Term	Type	Identity
Sma3	CMP/dCMP deaminase, zinc-binding	IPR002125	-	-
Sma3	Bacterial bifunctional deaminase-reductase, C-terminal	IPR002734	-	-
Sma3	Riboflavin biosynthesis protein RibD	IPR004794	-	-
Sma3	Riboflavin-specific deaminase, C-terminal	IPR011549	-	-
Sma3	Conserved hypothetical protein CHP02464	IPR012816	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: A9TQ72

Fln msg: Distance to subject end: 257 aas, your sequence is shorter than subject: 94 - 598

Fln protein: MWIVMSRTLNLPEDANLWDVSSTQTIVATQRGARRDFQRRLASKGVEVVEFDILTPRAVMDYCYDRGFLSVLWECGGALSAPAIAFGVIHKVIA

Protein Length: 95

Fln nts: AATGTGGATTGTTATGTCAAGAACTTTGAATCTACCTGAAGATGCAAATCTTTGGGATGTATCTTCTACTCAAACTATAGTAGCAACACAAAGGGGAGCTCGTAGGGACTTTCAAAGGAGACTCGCATCGAAAGGTGTGGAAGTTGTGGAATTCGACATTCTAACACCAAGAGCTGTCATGGATTACTGCTATGACAGAGGCTTTCTTTCTGTATTATGGGAGTGCGGAGGGGCTTTGTCGGCCCCAGCTATTGCATTTGGTGTTATTCACAAGGTGATTGCC

Fln Alignment:

Contig8767___IVMSRTLNLPEDANLWDVSSTQTIVATQRGARRDFQRRLASKGVEVVEFDILTPRAVMDYCYDRGFLSVLWECGGALSAPAIAFGVIHKVIA
A9TQ72_________________IVMSRCLNLPMDANLWDVSTTQTIVTTQKGARQDFQALLASRGVEVVEFDFLTPRAVMDYCYNRGYLSILWECGGMLSAPAIASGVIQKVMA

SNPs (tot: 2)

Position	A %	C %	G %	T %	Probability
75	66		33		0.997452
76		66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain