SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene5117

Length: 413 nt

UniGene Fasta

>biog3_v1.0_unigene5117
AATGTAGAGTGGAGAAGACGGGAGATGGTGAGAAATTGAGTCTGCCGTTGTATTTGGCTAGATTTCTGGCACTGGTTTGGAAGAAGATGACTACTTTCTCCTTTTCTGATTGGCTCAGCTGGTGGCCGCTGTGGCAGCGGGAGAAGAGGTTAGAGCAACTCCTTGCGCAGGCGAACGCCAATCCGAGAGATGTTTCCAAGCAGAGCGCTCTTCTGGCAGAACTCAATAAGCACAGTCCTGAAGCTGTTATTAAGCGTTTTGAGCAAAGAGATCATGCCACAGATAGTCGGGCAGTTGCAGAATATCTTCGAGCACTCGTTGTTACAAATGCAATACATTGTATCTACCAGATGAACGTTCGGGCAAACCTTCCAGCCTTCCTGCACTGTTGTTAGAGTTAAAGCAGCGGGCAT

Ace file of the UniGene biog3_v1.0_unigene5117

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene11007	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	ATP-dependent peptidase, putative n=1 Tax=Ricinus communis RepID=B9RIL2_RICCO	-	-	70%
FL-Next	sp=ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial; Arabidopsis thaliana (Mouse-ear cress).	-	-	69%
Blast2go	atp-dependent zinc metalloprotease ftsh chloroplastic mitochondrial-like	-	-	81%

Source	ECs	Term	Type	e value	Identity
Blast2go	Hydrolases, Acting on peptide bonds (peptide hydrolases), Metalloendopeptidases.	EC:3.4.24.-	-	0.0	81%
Blast2go	Microtubule-severing ATPase.	EC:3.6.4.3	-	0.0	81%

Source	GOs	Term	Type	Identity
Blast2go	ATP catabolic process	GO:0006200	Biological Process	81%
Blast2go	PSII associated light-harvesting complex II catabolic process	GO:0010304	Biological Process	81%
Blast2go	response to heat	GO:0009408	Biological Process	81%
Blast2go	proteolysis	GO:0006508	Biological Process	81%
Blast2go	response to high light intensity	GO:0009644	Biological Process	81%
Blast2go	nucleic acid binding	GO:0003676	Molecular Function	81%
Blast2go	ATP-dependent peptidase activity	GO:0004176	Molecular Function	81%
Blast2go	metalloendopeptidase activity	GO:0004222	Molecular Function	81%
Blast2go	ATP binding	GO:0005524	Molecular Function	81%
Blast2go	microtubule-severing ATPase activity	GO:0008568	Molecular Function	81%
Blast2go	mitochondrion	GO:0005739	Cellular Component	81%
Blast2go	chloroplast	GO:0009507	Cellular Component	81%
Blast2go	membrane	GO:0016020	Cellular Component	81%

Source	InterPros	Term	Type	Identity
Sma3	Ribosomal protein S7	IPR000235	-	-
Sma3	RNA recognition motif domain	IPR000504	-	-
Sma3	Peptidase M41	IPR000642	-	-
Sma3	Caspase Recruitment	IPR001315	-	-
Sma3		IPR001984	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	ATPase, AAA-type, conserved site	IPR003960	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Peptidase, FtsH	IPR005936	-	-
Sma3	Twin-arginine translocation pathway, signal sequence	IPR006311	-	-
Sma3	Peptidase M41, FtsH extracellular	IPR011546	-	-
Sma3	Nucleotide-binding, alpha-beta plait	IPR012677	-	-
Sma3	Polysaccharide lyase 8, N-terminal alpha-helical	IPR012970	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR017909	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9FGM0

Fln msg: Separated hits, possible frame ERROR between 335 and 341, Distance to subject end: 543 aas, your sequence is shorter than subject: 137 - 806

Fln protein: CRVEKTGDGEKLSLPLYLARFLALVWKKMTTFSFSDWLSWWPLWQREKRLEQLLAQANANPRDVSKQSALLAELNKHSPEAVIKRFEQRDHATDSRAVAEYLRALVVTNAxxxYLPDERSGKPSSLPALLLELKQRA

Protein Length: 138

Fln nts: AATGTAGAGTGGAGAAGACGGGAGATGGTGAGAAATTGAGTCTGCCGTTGTATTTGGCTAGATTTCTGGCACTGGTTTGGAAGAAGATGACTACTTTCTCCTTTTCTGATTGGCTCAGCTGGTGGCCGCTGTGGCAGCGGGAGAAGAGGTTAGAGCAACTCCTTGCGCAGGCGAACGCCAATCCGAGAGATGTTTCCAAGCAGAGCGCTCTTCTGGCAGAACTCAATAAGCACAGTCCTGAAGCTGTTATTAAGCGTTTTGAGCAAAGAGATCATGCCACAGATAGTCGGGCAGTTGCAGAATATCTTCGAGCACTCGTTGTTACAAATGCAATxxxxxxGTATCTACCAGATGAACGTTCGGGCAAACCTTCCAGCCTTCCTGCACTGTTGTTAGAGTTAAAGCAGCGGGCAT

Fln Alignment:

Contig5117___DWLSWWPLWQREKRLEQLLAQANANPRDVSKQSALLAELNKHSPEAVIKRFEQRDHATDSRAVAEYLRALVVTNAIxxYLPDERSGKPSSLPALLLELKQRA
Q9FGM0_________________EWLSWWPFSRQEKRLEKLIAEADANPKDAALQGALLAELNKHIPEAVVQRFEQREHTVDSRGVAEYIRALVITNAIxxYLPDEQTGKPSSLPALLQELKHRA

SNPs (tot: 3)

Position	A %	C %	G %	T %	Probability
202		75		25	0.996473
340			33	66	0.997452
341	33			66	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain