SustainPineDB

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene4989

Length: 851 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

Ace file of the UniGene biog3_v1.0_unigene4989 (antisense)

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene9331	14/15
SustainPine v2.0	sp_v2.0_unigene28123	1/15

Source	Descriptions	Term	Type	Identity
AutoFact	translation initiation factor eIF-2 gamma subunit [Arabidopsis thaliana] gb\|AAK29674.1\|AF353097_1 protein synthesis initiation factor eIF2 gamma [Arabidopsis thaliana] gb\|AAC16745.1\| Strong similarity to initiation factor eIF-2, gb\|U37354 from S. pombe. E	-	-	88%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	91%
Blast2go	eukaryotic translation initiation factor 2 subunit 3	-	-	96%

Source	GOs	Term	Type	Identity
Blast2go	translational initiation	GO:0006413	Biological Process	96%
Blast2go	GTP catabolic process	GO:0006184	Biological Process	96%
Blast2go	translation initiation factor activity	GO:0003743	Molecular Function	96%
Blast2go	GTPase activity	GO:0003924	Molecular Function	96%
Blast2go	GTP binding	GO:0005525	Molecular Function	96%

Source	InterPros	Term	Type	Identity
Sma3	Translation initiation factor 2, gamma subunit, C-terminal	IPR015256	-	-
Sma3	Protein synthesis factor, GTP-binding	IPR000795	-	-
Sma3	Translation elongation factor EFTu/EF1A, domain 2	IPR004161	-	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LL29

Fln msg: Overlapping hits, possible frame ERROR between 574 and 429, Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 264 - 464

Fln protein: M*GVIADGAPVVPISAQLKYNIDVVCEYITNKIPIPERNFVDPPNMIVIRSFDVNKPGAEVDDIKGGVAGGSILKGVLKVNQKIEVRPGIVVKDEGGNIKCTPIFSRIISLYAEQNELQFAVPGGLIGVGTTIDPMLTRADRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVLMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSKGEKMALSRRVEKHWRLIGWGQIQAGAMLDIPPASE*

Protein Length: 265

Fln nts: AATGTAGGGTGTTATCGCTGATGGAGCACCTGTAGTACCAATATCTGCACAACTGAAATACAATATCGATGTTGTCTGCGAATACATAACAAACAAGATTCCCATTCCAGAGCGTAATTTTGTTGATCCACCCAATATGATCGTTATCAGATCTTTTGATGTAAATAAGCCTGGTGCTGAAGTTGATGACATAAAAGGAGGTGTTGCAGGTGGAAGTATACTGAAGGGTGTTTTGAAGGTGAATCAAAAAATTGAAGTTCGTCCTGGCATTGTTGTCAAGGACGAGGGTGGCAACATCAAGTGTACGCCCATCTTTTCAAGAATAATTTCACTTTATGCTGAGCAGAACGAGTTGCAGTTTGCTGTTCCTGGCGGCCTTATTGGTGTGGGTACCACAATAGATCCCATGCTGACACGTGCTGACAGGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAAGTTCTGATGCTTAATATTGGTTCAATGTCCACTGGAGCTCGGGTGCTTGCTGTGAAGAATGACCTGGCCAAGCTCCAACTTACTTCTCCAGTGTGCACAAGTAAAGGTGAAAAGATGGCACTTAGCAGGCGAGTAGAAAAGCATTGGCGATTGATAGGATGGGGTCAAATTCAAGCTGGAGCAATGCTGGACATACCCCCGGCATCTGAATAAGATAGTGCACACACAAAACCCAATTATACTTGAGAAAATAAAAAGGGTACCTGAGACATT

Fln Alignment:

Contig4989___GVIADGAPVVPISAQLKYNIDVVCEYITNKIPIPERNFVDPPNMIVIRSFDVNKPGAEVDDIKGGVAGGSILKGVLKVNQKIEVRPGIVVKDEGGNIKCTPIFSRIISLYAEQNELQFAVPGGLIGVGTTIDPMLTRADRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVLMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSKGEKMALSRRVEKHWRLIGWGQIQAGAMLDIPPASE
B8LL29_________________GTIADGAPVVPISAQLKYNIDVVCEYITNKIPIPERNFVDPPNMIVIRSFDVNKPGAEVDEIKGGVAGGSILKGVLKVNQKIEVRPGIVVKDESGNIKCTPIFSRIISLYAEQNELQFAVPGGLIGVGTTIDPTLTRADRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVLMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSKGEKMALSRRVEKHWRLIGWGQIQAGAMLDIPPASE

SNPs (tot: 38)

Position	A %	C %	G %	T %	Probability
108	25		75		0.996473
111		75	25		0.996473
112		75		25	0.996473
543	33		66		0.997452
546		66		33	0.997452
559		33		66	0.997452
561	33		66		0.997452
566		66		33	0.997452
567		66		33	0.997452
570	33		66		0.997452
588	33			66	1.0
591	66		33		0.997452
615		80		20	0.995493
621	80	20			0.995493
642	71		28		1.0
645	14			85	0.993533
648	85		14		0.993533
663			85	14	0.993533
669	85	14			0.993533
690		14		85	0.993533
708	87			12	0.992554
738	85	14			0.993533
763	14		85		0.993533
764		14		85	0.993533
769	14			85	0.993533
774	16		83		0.994512
786	16		83		0.994512
789	83		16		0.994512
810			16	83	0.994512
813		16		83	0.994512
819	16			83	0.994512
823			83	16	0.994512
824	16		66	16	0.988813
825		20		80	0.995493
826	20		80		0.995493
827		80		20	0.995493
836			66	33	0.997452
837		66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain