SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene4577

Length: 325 nt

UniGene Fasta

>biog3_v1.0_unigene4577
TTGAAGAGCTGTGGGCTCTATTGCATTTTCTTGATCAGGACAAGTTCAGGAATAAGGACGATTTTGTGGAGAAATACAAGAACTTGAGCTCAATCAACGAGAATGTGCTTGCTAATCTACACACAGAGCTTCGGCCTCATCTGCTCCGAAGAGTCATCAAAGATGTTGAGAAATCTTTGCCGCCAAAGATAGAACGCATTTTAAGAGTTGAGATGTCTCCTTTTCAGAAACAGTACTACAAAATGGATTTTGGAGCGGAACTTTCATGATTTGAATAAGGGAGTGCGTGGAAACCAGGTTTCACTATTAAATGTTGTTGTCGAAT

Ace file of the UniGene biog3_v1.0_unigene4577

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene8865	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	SNF2 family DNA-dependent ATPase (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TTS1_PHYPA	-	-	95%
FL-Next	sp=CHD3-type chromatin-remodeling factor PICKLE; Arabidopsis thaliana (Mouse-ear cress).	-	-	50%
Blast2go	chromodomain-helicase-dna-binding protein 2-like	-	-	95%

Source	GOs	Term	Type	Identity
Blast2go	chromatin assembly or disassembly	GO:0006333	Biological Process	95%
Blast2go	helicase activity	GO:0004386	Molecular Function	95%
Blast2go	DNA binding	GO:0003677	Molecular Function	95%
Blast2go	chromatin binding	GO:0003682	Molecular Function	95%
Blast2go	ATP binding	GO:0005524	Molecular Function	95%
Blast2go	transferase activity	GO:0016740	Molecular Function	95%
Blast2go	chromatin	GO:0000785	Cellular Component	95%
Blast2go	nucleus	GO:0005634	Cellular Component	95%

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	SNF2-related	IPR000330	-	-
Sma3		IPR000910	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	Bromodomain	IPR001487	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Zinc finger, PHD-type	IPR001965	-	-
Sma3	DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site	IPR002464	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	2-oxo acid dehydrogenase, lipoyl-binding site	IPR003016	-	-
Sma3	FY-rich, N-terminal	IPR003888	-	-
Sma3	FY-rich, C-terminal	IPR003889	-	-
Sma3	Rubredoxin-type fold	IPR004039	-	-
Sma3	HSA	IPR006562	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	Agenet	IPR008395	-	-
Sma3	Domain of unknown function DUF1086	IPR009462	-	-
Sma3	Domain of unknown function DUF1087	IPR009463	-	-
Sma3		IPR012287	-	-
Sma3	Vps54-like	IPR012501	-	-
Sma3	HAS subgroup	IPR013999	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3	Helicase/SANT-associated, DNA binding	IPR014012	-	-
Sma3		IPR014021	-	-
Sma3		IPR014778	-	-
Sma3	Glutamine-Leucine-Glutamine, QLQ	IPR014978	-	-
Sma3	ATPase, nucleosome remodelling ISWI, HAND domain	IPR015194	-	-
Sma3	SLIDE domain	IPR015195	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	SANT domain	IPR017884	-	-
Sma3	Zinc finger, RING-type, conserved site	IPR017907	-	-
Sma3	AT hook, DNA-binding motif	IPR017956	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Bromodomain, conserved site	IPR018359	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-
Sma3	Isocitrate lyase/phosphorylmutase, conserved site	IPR018523	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9S775

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 820 aas, your sequence is shorter than subject: 89 - 1384

Fln protein: EELWALLHFLDQDKFRNKDDFVEKYKNLSSINENVLANLHTELRPHLLRRVIKDVEKSLPPKIERILRVEMSPFQKQYYKMDFGAELS*

Protein Length: 90

Fln nts: TTGAAGAGCTGTGGGCTCTATTGCATTTTCTTGATCAGGACAAGTTCAGGAATAAGGACGATTTTGTGGAGAAATACAAGAACTTGAGCTCAATCAACGAGAATGTGCTTGCTAATCTACACACAGAGCTTCGGCCTCATCTGCTCCGAAGAGTCATCAAAGATGTTGAGAAATCTTTGCCGCCAAAGATAGAACGCATTTTAAGAGTTGAGATGTCTCCTTTTCAGAAACAGTACTACAAAATGGATTTTGGAGCGGAACTTTCATGATTTGAATAAGGGAGTGCGTGGAAACCAGGTTTCACTATTAAATGTTGTTGTCGAAT

Fln Alignment:

Contig4577___EELWALLHFLDQDKFRNKDDFVEKYKNLSSINENVLANLHTELRPHLLRRVIKDVEKSLPPKIERILRVEMSPFQKQYYKMDF
Q9S775_________________DELFMLMHFLDAGKFGSLEEFQEEFKDINQ--EEQISRLHKMLAPHLLRRVKKDVMKDMPPKKELILRVDLSSLQKEYYKAIF

SNPs (tot: 4)

Position	A %	C %	G %	T %	Probability
212	25		75		0.996473
222		25		75	0.996473
246	25		75		0.996473
247		25	75		0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain