|
||||||
|
UniGene Name: biog3_v1.0_unigene4369
Length: 229 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene4369
A |
|
Ace file of the UniGene biog3_v1.0_unigene4369
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4211 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA mismatch repair protein PMS2 [Arabidopsis thaliana] gb|AAL01156.1| DNA mismatch repair protein [Arabidopsis thaliana] gb|AEE82175.1| DNA mismatch repair protein PMS2 [Arabidopsis thaliana] | - | - | 0.0 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Blast2go | dna mismatch repair protein | - | - | 0.0 | 73% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | seed development | GO:0048316 | Biological Process | 0.0 | 73% |
| Blast2go | DNA recombination | GO:0006310 | Biological Process | 0.0 | 73% |
| Blast2go | mismatch repair | GO:0006298 | Biological Process | 0.0 | 73% |
| Blast2go | pollen development | GO:0009555 | Biological Process | 0.0 | 73% |
| Blast2go | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | 73% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 73% |
| Blast2go | catalytic activity | GO:0003824 | Molecular Function | 0.0 | 73% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB93
Fln msg: Distance to subject end: 64 aas, atg_distance in limit (1-15): atg_distance = 11, your sequence is shorter than subject: 76 - 150
Fln protein:
M
Protein Length:
77
Fln nts:
A
Fln Alignment:
Contig4369___FVEDIDAPPGRRFLLSAVPYSQNITFGVEDVQELLSILADAPAPPT
D5AB93_________________FVEDTNAPPGRRFLLSAVPYSQNITFGLEDVQELLSILADAPAPPT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
