SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: biogeco3 v1.0

UniGene Name: biog3_v1.0_unigene1352

Length: 459 nt

UniGene Fasta

>biog3_v1.0_unigene1352
AGCAGGACAGCATGTTTGGGTAATGAATGTTGTACCAATAGATTCTCCTGACACACTTCCAATCATCTACGACCGTGGTTTATTTGGTATTTATCATGATTGGTGTCAGTCTTTCAGTACATACCCCAGGACATATGACCTTTTGCATGCTGATCACCTGTTCTCTAAGGTTAAGAAAAGGTGCCAATTGGAACCTGTAATGGCAGAGGTTGATCGGATATTACGGCCAGGAGGCTCTGCAATTTTTCGAGATAAATTAGATATAATAAATGAATTGGAGACCCTGATAAAATCATTGCACTGGGAGGTTCGACTCACATACTCAAAAGAGAAGGAAGGGATCCTGTGTGCACAGAAGACTATGTGGCGCCCGGCATCGTCCTGAATGTTTGCAAAAAATGTTTCATTTTTTACCAGGTTGACATGATATACGTGGCCCTGGAATTTAATCTACCTTGA

Ace file of the UniGene biog3_v1.0_unigene1352

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene14330	5/5

Source	Descriptions	Term	Type	Identity
AutoFact	ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RRE2_RICCO	-	-	63%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	52%
Blast2go	atp binding	-	-	83%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	0.0	83%

Source	KEGGs	Term	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	83%
Blast2go	Tetracycline biosynthesis	00253	83%
Blast2go	Histidine metabolism	00340	83%
Blast2go	Tyrosine metabolism	00350	83%
Blast2go	Phenylalanine metabolism	00360	83%
Blast2go	Tryptophan metabolism	00380	83%
Blast2go	Benzoxazinoid biosynthesis	00402	83%
Blast2go	Selenocompound metabolism	00450	83%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	83%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	83%
Blast2go	Methane metabolism	00680	83%
Blast2go	Porphyrin and chlorophyll metabolism	00860	83%
Blast2go	Carotenoid biosynthesis	00906	83%
Blast2go	Phenylpropanoid biosynthesis	00940	83%
Blast2go	Flavonoid biosynthesis	00941	83%
Blast2go	Anthocyanin biosynthesis	00942	83%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	83%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	83%
Blast2go	Insect hormone biosynthesis	00981	83%
Blast2go	Biosynthesis of type II polyketide products	01057	83%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	83%
Blast2go	Metabolic pathways	01100	83%
Blast2go	Biosynthesis of secondary metabolites	01110	83%

Source	GOs	Term	Type	e value	Identity
Blast2go	methylation	GO:0032259	Biological Process	0.0	83%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	0.0	83%

Source	InterPros	Term	Type	Identity
Sma3	Cystathionine beta-synthase, core	IPR000644	-	-
Sma3	Glycoside hydrolase, family 10	IPR001000	-	-
Sma3	Flavodoxin	IPR001094	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Zinc finger, PHD-type	IPR001965	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Domain of unknown function DUF21	IPR002550	-	-
Sma3	Putative S-adenosyl-L-methionine-dependent methyltransferase	IPR004159	-	-
Sma3	Radical SAM	IPR007197	-	-
Sma3	Cytokine-induced anti-apoptosis inhibitor 1	IPR007785	-	-
Sma3	Flavodoxin/nitric oxide synthase	IPR008254	-	-
Sma3	tRNA wybutosine-synthesis	IPR013917	-	-
Sma3		IPR017909	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-
Sma3	Zinc finger, C3HC4 RING-type	IPR018957	-	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LME5

Fln msg: your sequence is shorter than subject: 128 - 188

Fln protein: AGQHVWVMNVVPIDSPDTLPIIYDRGLFGIYHDWCQSFSTYPRTYDLLHADHLFSKVKKRCQLEPVMAEVDRILRPGGSAIFRDKLDIINELETLIKSLHWEVRLTYSKEKEGILCAQKTMWRPASS*

Protein Length: 129

Fln nts: AGCAGGACAGCATGTTTGGGTAATGAATGTTGTACCAATAGATTCTCCTGACACACTTCCAATCATCTACGACCGTGGTTTATTTGGTATTTATCATGATTGGTGTCAGTCTTTCAGTACATACCCCAGGACATATGACCTTTTGCATGCTGATCACCTGTTCTCTAAGGTTAAGAAAAGGTGCCAATTGGAACCTGTAATGGCAGAGGTTGATCGGATATTACGGCCAGGAGGCTCTGCAATTTTTCGAGATAAATTAGATATAATAAATGAATTGGAGACCCTGATAAAATCATTGCACTGGGAGGTTCGACTCACATACTCAAAAGAGAAGGAAGGGATCCTGTGTGCACAGAAGACTATGTGGCGCCCGGCATCGTCCTGA___ATGTTTGCAAAAAATGTTTCATTTTTTACCAGGTTGACATGATATACGTGGCCCTGGAATTTAATCTACCTTGA

Fln Alignment:

Contig1352___WVMNVVPIDSPDTLPIIYDRGLFGIYHDWCQSFSTYPRTYDLLHADHLFSKVKKRCQLEPVMAEVDRILRPGGSAIFRDKLDIINELETLIKSLHWEVRLTYSKEKEGILCAQKTMW
B8LME5_________________WVMNVVPVSGPNTLPVIYDRGLIGVAHDWCEPFDTHPRTYDLLHASGLFSIEKRRCEIAYIILEMDRILRPGGHAYIQDSLSILVEIEAIAKSVGW--RTIMFDTEEGTYGSRKVLY

SNPs (tot: 4)

Position	A %	C %	G %	T %	Probability
261		16	83		0.994512
324	25			75	0.996473
327	75			25	0.996473
328	75			25	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain