|
||||||
|
UniGene Name: biog3_v1.0_unigene205
Length: 161 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene205
G |
|
Ace file of the UniGene biog3_v1.0_unigene205
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene8402 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative GMP synthase [Arabidopsis thaliana] | - | - | 0.0 | 71% |
| FL-Next | tr=GMP synthase, putative; Ricinus communis (Castor bean). | - | - | 0.0 | 86% |
| Blast2go | gmp synthase | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | GMP synthase (glutamine-hydrolyzing). | EC:6.3.5.2 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 83% | |
| Blast2go | Drug metabolism - other enzymes | 00983 | 0.0 | 83% | |
| Blast2go | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
| Blast2go | Asparagine synthase (glutamine-hydrolyzing). | EC:6.3.5.4 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 83% | |
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | glutamine metabolic process | GO:0006541 | Biological Process | 0.0 | 83% |
| Blast2go | tRNA processing | GO:0008033 | Biological Process | 0.0 | 83% |
| Blast2go | asparagine biosynthetic process | GO:0006529 | Biological Process | 0.0 | 83% |
| Blast2go | GMP biosynthetic process | GO:0006177 | Biological Process | 0.0 | 83% |
| Blast2go | GMP synthase (glutamine-hydrolyzing) activity | GO:0003922 | Molecular Function | 0.0 | 83% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 83% |
| Blast2go | transferase activity | GO:0016740 | Molecular Function | 0.0 | 83% |
| Blast2go | asparagine synthase (glutamine-hydrolyzing) activity | GO:0004066 | Molecular Function | 0.0 | 83% |
| Blast2go | cytoplasm | GO:0005737 | Cellular Component | 0.0 | 83% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamine amidotransferase type 1 | IPR017926 | - | 0.0 | - |
| Sma3 | IPR000991 | - | 0.0 | - | |
| Sma3 | GMP synthase, C-terminal | IPR001674 | - | 0.0 | - |
| Sma3 | GMP synthase, N-terminal | IPR004739 | - | 0.0 | - |
| Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
| Sma3 | IPR018318 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9SP14
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 53 - 353
Fln protein:
G
Protein Length:
54
Fln nts:
G
Fln Alignment:
Contig205___GRKPMFLVQGTLYPDVIESCPPPGSGRNHSHTIKSHHNVGGLPEEMNLKLIEP
B9SP14________________GKKPAYLVQGTLYPDVIESCPPPGSGRTHSHTIKSHHNVGGLPKDMKLKLIEP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
